PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00024622-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 884aa    MW: 96491.9 Da    PI: 7.0986
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00024622-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.6e-14347392148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T+eE++l ++++  lG++ W++Ia  ++ gRt++++k+ w+++l
  WALNUT_00024622-RA 347 RGPFTPEEEKLVIRLHGILGNR-WAAIACQLP-GRTDNEIKNLWNTHL 392
                         89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501419.499156199IPR002466Adenosine deaminase/editase
PfamPF021371.7E-6157224IPR002466Adenosine deaminase/editase
SMARTSM005529.7E-80303881IPR002466Adenosine deaminase/editase
Gene3DG3DSA:1.10.10.606.9E-22341397IPR009057Homeodomain-like
SuperFamilySSF466894.81E-13342398IPR009057Homeodomain-like
PROSITE profilePS5129423.087342396IPR017930Myb domain
SMARTSM007175.1E-13346394IPR001005SANT/Myb domain
PfamPF002494.7E-13347392IPR001005SANT/Myb domain
CDDcd001671.09E-9349392No hitNo description
PfamPF021377.9E-85515874IPR002466Adenosine deaminase/editase
PROSITE profilePS5014151.325515880IPR002466Adenosine deaminase/editase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006396Biological ProcessRNA processing
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
GO:0004000Molecular Functionadenosine deaminase activity
Sequence ? help Back to Top
Protein Sequence    Length: 884 aa     Download sequence    Send to blast
MSGLSFVSPQ LISPPCEPPT FVELSTRPSK FSSTSVGIKN DSVGPPLGSQ RPTQTRAAAS  60
DDSEKPSAVT SQQLKGASNI PAVPIVPGSQ EGPEIRKPSI DSGQCLAQRR MTTYGDSKEG  120
STVMEMGEID EGEGLELFTG TGLQQISMHH VLHSLISGAL LSYFLLPVYL SSVTVGGSPN  180
SPEEFCLEDC LRIALYDRIQ PQDTHDHFLL KTNNSPAIFL TYGHGTTDNP TNSPPVQLMG  240
LVPRPPLLKG LLVSMSSLPL VVPALLNQKP PLTTPPASTI LFHLSLGLEC ISDLSRVNMA  300
EASWGERVAE KVFSLYNSLP KKGKPQGREV TVLAAFLLSS PSQDIKRGPF TPEEEKLVIR  360
LHGILGNRWA AIACQLPGRT DNEIKNLWNT HLKKRLICMG LDPQTHEPVT SCSTNIKASA  420
SPTTRHIAQW ESARLEAEAR LSTESSLFNP VPVGGSDSDY FLRIWNSEVG ESFRKFSMGE  480
KTLCQNSVSQ ASSSTKCGSI SPVTTEIGTI LAVVALGTGT KCIGRSLLSQ RGDVVNDSHA  540
EIIARRALLR FFYAQIQGLA HFHSKQNYID GSSKLQGCDI NDLPFQLDPD SLGQVKYTLK  600
PGWQLHLFIS QPPCGFASLS CLLFPPNCNP SRERDSQPNM GDLNNSISEP WEVLVKNNGV  660
ASQHIGSVQR KPGRGDTTSS VSCSDKIARW NVVGVQGALL SYFLLPVYLS SVTVGGSPNS  720
PEEFCLEDCL RIALYDRIQP LSNEITSPFQ VNQPLFWAAP IPPKEFQHSE TALSTLTCGY  780
SICWNRSGLH EVILGTTGRK QGTSAKGALF PSTESSLCKK RLLEIFLSLE HECQTEYPAN  840
EISYRALKQR AQEYMTMSKL FKGSQPFSNW LLKPVDTEAF SIFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hp3_D7e-3151388270401Double-stranded RNA-specific editase 1
5hp3_A7e-3151388270401Double-stranded RNA-specific editase 1
5hp2_D7e-3151388270401Double-stranded RNA-specific editase 1
5hp2_A7e-3151388270401Double-stranded RNA-specific editase 1
1zy7_B7e-3151388270401RNA-specific adenosine deaminase B1, isoform
1zy7_A7e-3151388270401RNA-specific adenosine deaminase B1, isoform
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-62myb domain protein 17